Solution structure of sla1 homology domain 1
PDB DOI: 10.2210/pdb2hbp/pdb
Classification: ENDOCYTOSIS, PROTEIN BINDING Organism(s): Saccharomyces Cerevisiae
Deposited: 2006-06-14 Deposition Author(s): Mahadev, R.K. , Overduin, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of sla1 homology domain 1
Primary Citation of Related Structures: 2HBP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytoskeleton assembly control protein SLA1 | A | 68 | Saccharomyces Cerevisiae | GSKKSRLWVDRSGTFKVDAEFIGCAKGKIHLHKANGVKIAVAADKLSNEDLAYVEKITGFSLEKFKAN |
Method: SOLUTION NMR
Deposited Date: 2006-06-14 Deposition Author(s): Mahadev, R.K. , Overduin, M.