Crystal structure of a thioesterase superfamily protein (cc_3309) from caulobacter vibrioides at 1.85 a resolution
PDB DOI: 10.2210/pdb2hbo/pdb
Classification: HYDROLASE Organism(s): Caulobacter Vibrioides
Deposited: 2006-06-14 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of a thioesterase superfamily protein (cc_3309) from caulobacter vibrioides at 1.85 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 2HBO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hypothetical protein (np_422103.1) | A | 158 | Caulobacter Vibrioides | GMSDDLTDAQTAAIPEGFSQLNWSRGFGRQIGPLFEHREGPGQARLAFRVEEHHTNGLGNCHGGMLMSFADMAWGRIISLQKSYSWVTVRLMCDFLSGAKLGDWVEGEGELISEEDMLFTVRGRIWAGERTLITGTGVFKALSARKPRPGELAYKEEA |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-14 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)