Crystal structure of n-terminal domain of ribosomal protein l9 (ntl9) k12m
PDB DOI: 10.2210/pdb2hba/pdb
Classification: RNA BINDING PROTEIN Organism(s): Geobacillus Stearothermophilus
Deposited: 2006-06-14 Deposition Author(s): Cho, J.-H. , Kim, E.Y. , Raleigh, D.P. , Schindelin, H.
Method: X-RAY DIFFRACTION Resolution: 1.25 Å
Crystal structure of n-terminal domain of ribosomal protein l9 (ntl9) k12m
Cho, J.-H. , Kim, E.Y. , Raleigh, D.P. , Schindelin, H.
Primary Citation of Related Structures: 2HBA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 50S ribosomal protein L9 | A | 52 | Geobacillus Stearothermophilus | MKVIFLKDVKGMGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQ |
| 50S ribosomal protein L9 | B | 52 | Geobacillus Stearothermophilus | MKVIFLKDVKGMGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-14 Deposition Author(s): Cho, J.-H. , Kim, E.Y. , Raleigh, D.P. , Schindelin, H.