An episulfide cation (thiiranium ring) trapped in the active site of hav 3c proteinase inactivated by peptide-based ketone inhibitors
PDB DOI: 10.2210/pdb2hal/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Hepatitis A Virus , Synthetic Construct
Deposited: 2006-06-13 Deposition Author(s): Bergmann, E.M. , Cherney, M.M. , James, M.N. , Yin, J.
An episulfide cation (thiiranium ring) trapped in the active site of hav 3c proteinase inactivated by peptide-based ketone inhibitors
Bergmann, E.M. , Cherney, M.M. , James, M.N. , Yin, J.
Primary Citation of Related Structures: 2HAL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hepatitis A Protease 3C | A | 212 | Hepatitis A Virus , Synthetic Construct | STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI |
| N-ACETYL-LEUCYL-PHENYLALANYL-PHENYLALANYL-GLUTAMATE-FLUOROMETHYLKETONE INHIBITOR | I | 6 | Hepatitis A Virus , Synthetic Construct | XLFFEX |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-13 Deposition Author(s): Bergmann, E.M. , Cherney, M.M. , James, M.N. , Yin, J.