The structure of fiv 12s protease in complex with tl-3
PDB DOI: 10.2210/pdb2hah/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Feline Immunodeficiency Virus (Isolate Petaluma)
Deposited: 2006-06-12 Deposition Author(s): Elder, J.H. , Heaslet, H. , Lin, Y.C. , Stout, C.D.
The structure of fiv 12s protease in complex with tl-3
Elder, J.H. , Heaslet, H. , Lin, Y.C. , Stout, C.D.
Primary Citation of Related Structures: 2HAH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease | A | 116 | Feline Immunodeficiency Virus (Isolate Petaluma) | YNKVGTTTTLEKRPEILIFVNGYPIKFLLDTGADITVLNRRDFQVKNSIENGRQMIGGIGGFIRGTNYINVHLEIRDENYKTQCIFGNVCVLEDNSTPVNILGRDNMIKFNIRLVM |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-06-12 Deposition Author(s): Elder, J.H. , Heaslet, H. , Lin, Y.C. , Stout, C.D.