Docking and dimerization domain (d/d) of the regulatory subunit of the type ii-alpha camp-dependent protein kinase a associated with a peptide derived from an a-kinase anchoring protein (akap)
PDB DOI: 10.2210/pdb2h9r/pdb
Classification: TRANSFERASE Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2006-06-10 Deposition Author(s): Coghlan, V. , Hausken, Z.E. , Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.
Method: SOLUTION NMR Resolution: N.A.
Docking and dimerization domain (d/d) of the regulatory subunit of the type ii-alpha camp-dependent protein kinase a associated with a peptide derived from an a-kinase anchoring protein (akap)
Coghlan, V. , Hausken, Z.E. , Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.
Primary Citation of Related Structures: 2H9R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase type II-alpha regulatory subunit | A | 46 | Rattus Norvegicus , Synthetic Construct | HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR |
| cAMP-dependent protein kinase type II-alpha regulatory subunit | B | 46 | Rattus Norvegicus , Synthetic Construct | HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR |
| 22-mer from A-kinase anchor protein 5 | C | 22 | Rattus Norvegicus , Synthetic Construct | LLIETASSLVKNAIQLSIEQLV |
Method: SOLUTION NMR
Deposited Date: 2006-06-10 Deposition Author(s): Coghlan, V. , Hausken, Z.E. , Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.