Solution structure of the talin f3 domain in complex with a chimeric beta3 integrin-pip kinase peptide- minimized average structure
PDB DOI: 10.2210/pdb2h7e/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-06-02 Deposition Author(s): Wegener, K.L.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the talin f3 domain in complex with a chimeric beta3 integrin-pip kinase peptide- minimized average structure
Primary Citation of Related Structures: 2H7E
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Talin-1 | A | 101 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PLGSGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKS |
Chimera of 24-mer peptide from Integrin beta-3 and 10-mer peptide from Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma | B | 34 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KLLITIHDRKEFAKFEEERARAKWVYSPLHYSAR |
Method: SOLUTION NMR
Deposited Date: 2006-06-02 Deposition Author(s): Wegener, K.L.