Crystal structure of human caspase-1 (thr388->ala) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
PDB DOI: 10.2210/pdb2h54/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2006-05-25 Deposition Author(s): Romanowski, M.J. , Scheer, J.M. , Wells, J.A.
Crystal structure of human caspase-1 (thr388->ala) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Romanowski, M.J. , Scheer, J.M. , Wells, J.A.
Primary Citation of Related Structures: 2H54
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Caspase-1 | A | 178 | Homo Sapiens , Synthetic Construct | NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD |
| Caspase-1 | B | 88 | Homo Sapiens , Synthetic Construct | AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPATERVTLTRCFYLFPGH |
| N-[(benzyloxy)carbonyl]-L-valyl-N-[(2S)-1-carboxy-4-fluoro-3-oxobutan-2-yl]-L-alaninamide | C | 5 | Homo Sapiens , Synthetic Construct | XVADX |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-05-25 Deposition Author(s): Romanowski, M.J. , Scheer, J.M. , Wells, J.A.