Crystal structure of the pdx1 homeodomain in complex with dna
PDB DOI: 10.2210/pdb2h1k/pdb
Classification: Transcription/DNA Organism(s): Leucoagaricus Meleagris , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-05-16 Deposition Author(s): Guanga, G.P. , Longo, A. , Rose, R.B.
Method: X-RAY DIFFRACTION Resolution: 2.42 Å
Crystal structure of the pdx1 homeodomain in complex with dna
Guanga, G.P. , Longo, A. , Rose, R.B.
Primary Citation of Related Structures: 2H1K
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Pancreatic and duodenal homeobox 1 | A | 63 | Leucoagaricus Meleagris , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSNKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEED |
Pancreatic and duodenal homeobox 1 | B | 63 | Leucoagaricus Meleagris , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSNKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEED |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-05-16 Deposition Author(s): Guanga, G.P. , Longo, A. , Rose, R.B.