2H1K
Crystal structure of the pdx1 homeodomain in complex with dna
PDB DOI: 10.2210/pdb2h1k/pdb
Classification: Transcription/DNA Organism(s): Mesocricetus Auratus , Synthetic Construct
Deposited: 2006-05-16 Deposition Author(s): Guanga, G.P. , Longo, A. , Rose, R.B.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.42 Å
Crystal structure of the pdx1 homeodomain in complex with dna
Guanga, G.P. , Longo, A. , Rose, R.B.
Primary Citation of Related Structures: 2H1K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pancreatic and duodenal homeobox 1 | A | 63 | Mesocricetus Auratus , Synthetic Construct | GSNKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEED |
| Pancreatic and duodenal homeobox 1 | B | 63 | Mesocricetus Auratus , Synthetic Construct | GSNKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEED |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-05-16 Deposition Author(s): Guanga, G.P. , Longo, A. , Rose, R.B.