Crystal structure of the za domain bound to z-rna
PDB DOI: 10.2210/pdb2gxb/pdb
Classification: hydrolase/RNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2006-05-08 Deposition Author(s): Athanasiadis, A. , Placido, D. , Rich, A.
Method: X-RAY DIFFRACTION Resolution: 2.25 Å
Crystal structure of the za domain bound to z-rna
Athanasiadis, A. , Placido, D. , Rich, A.
Primary Citation of Related Structures: 2GXB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Double-stranded RNA-specific adenosine deaminase | A | 66 | Homo Sapiens , Synthetic Construct | SHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSTQ |
Double-stranded RNA-specific adenosine deaminase | B | 66 | Homo Sapiens , Synthetic Construct | SHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSTQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-05-08 Deposition Author(s): Athanasiadis, A. , Placido, D. , Rich, A.