High-resolution solution structure of the salt-bridge defficient mouse defensin (e15d)-cryptdin4
PDB DOI: 10.2210/pdb2gwp/pdb
Classification: ANTIBIOTIC Organism(s): Mus Musculus
Deposited: 2006-05-05 Deposition Author(s): Craik, D.J. , Daly, N.L. , Ouellette, A.J. , Rosengren, K.J. , Vogel, H.J.
Method: SOLUTION NMR Resolution: N.A.
High-resolution solution structure of the salt-bridge defficient mouse defensin (e15d)-cryptdin4
Craik, D.J. , Daly, N.L. , Ouellette, A.J. , Rosengren, K.J. , Vogel, H.J.
Primary Citation of Related Structures: 2GWP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Defensin-related cryptdin 4 | A | 32 | Mus Musculus | GLLCYCRKGHCKRGDRVRGTCGIRFLYCCPRR |
Method: SOLUTION NMR
Deposited Date: 2006-05-05 Deposition Author(s): Craik, D.J. , Daly, N.L. , Ouellette, A.J. , Rosengren, K.J. , Vogel, H.J.