Solution structure of the sh3 domain of human ras gtpase-activating protein 1
PDB DOI: 10.2210/pdb2gqi/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2006-04-21 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Solution structure of the sh3 domain of human ras gtpase-activating protein 1
Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 2GQI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ras GTPase-activating protein 1 | A | 71 | Homo Sapiens | GSSGSSGRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2006-04-21 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.