Molecular characterization of the ran binding zinc finger domain
PDB DOI: 10.2210/pdb2gqe/pdb
Classification: TRANSPORT PROTEIN Organism(s): Salmonella Enterica
Deposited: 2006-04-20 Deposition Author(s): Alam, S.L. , Higa, M.M. , Sundquist, W.I. , Ullman, K.S.
Molecular characterization of the ran binding zinc finger domain
Alam, S.L. , Higa, M.M. , Sundquist, W.I. , Ullman, K.S.
Primary Citation of Related Structures: 2GQE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nuclear pore complex protein Nup153 | A | 32 | Salmonella Enterica | GHMVIGTWDCDTCLVQNKPEAIKCVACETPKP |
Method: SOLUTION NMR
Deposited Date: 2006-04-20 Deposition Author(s): Alam, S.L. , Higa, M.M. , Sundquist, W.I. , Ullman, K.S.