Crystal structure of a protein of unknown function from duf1488 family (shew_3726) from shewanella loihica pv-4 at 1.60 a resolution
PDB DOI: 10.2210/pdb2gpi/pdb
Classification: UNKNOWN FUNCTION Organism(s): Shewanella Loihica
Deposited: 2006-04-17 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of a protein of unknown function from duf1488 family (shew_3726) from shewanella loihica pv-4 at 1.60 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 2GPI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| conserved hypothetical protein | A | 91 | Shewanella Loihica | GMNQSIIFTEQLTWDVQLSAIHFTAQQQGMVIDCYIGQKVLEHLAAEKINNSEQALSLFEQFRFDIEEQAEKLIEQEAFDVQGHIQVERVD |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-04-17 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)