Three-dimensional structure of the trans-membrane domain of vpu from hiv-1 in aligned phospholipid bicelles
PDB DOI: 10.2210/pdb2goh/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 2006-04-12 Deposition Author(s): De Angelis, A.A. , Nevzorov, A.A. , Opella, S.J. , Park, S.H. , Wu, C.H.
Three-dimensional structure of the trans-membrane domain of vpu from hiv-1 in aligned phospholipid bicelles
De Angelis, A.A. , Nevzorov, A.A. , Opella, S.J. , Park, S.H. , Wu, C.H.
Primary Citation of Related Structures: 2GOH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
VPU protein | A | 35 | Human Immunodeficiency Virus 1 | QPIQIAIVALVVAIIIAIVVWSIVIIEGRGGKKKK |
Method: SOLUTION NMR
Deposited Date: 2006-04-12 Deposition Author(s): De Angelis, A.A. , Nevzorov, A.A. , Opella, S.J. , Park, S.H. , Wu, C.H.