Solution structure of the brinker dna binding domain in complex with the omb enhancer
PDB DOI: 10.2210/pdb2glo/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2006-04-05 Deposition Author(s): Affolter, M. , Cordier, F. , Grzesiek, S. , Hartmann, B. , Rogowski, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the brinker dna binding domain in complex with the omb enhancer
Affolter, M. , Cordier, F. , Grzesiek, S. , Hartmann, B. , Rogowski, M.
Primary Citation of Related Structures: 2GLO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
brinker CG9653-PA | A | 59 | Drosophila Melanogaster , Synthetic Construct | GSRRIFTPHFKLQVLESYRNDNDCKGNQRATARKYNIHRRQIQKWLQCESNLRSSVANN |
Method: SOLUTION NMR
Deposited Date: 2006-04-05 Deposition Author(s): Affolter, M. , Cordier, F. , Grzesiek, S. , Hartmann, B. , Rogowski, M.