Crystal structure of the sgpb:p14'-ala32 omtky3-del(1-5) complex
PDB DOI: 10.2210/pdb2gkv/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Meleagris Gallopavo , Streptomyces Griseus
Deposited: 2006-04-03 Deposition Author(s): James, M.N.G. , Laskowski Jr., M. , Lee, T.W. , Qasim, M.A.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of the sgpb:p14'-ala32 omtky3-del(1-5) complex
James, M.N.G. , Laskowski Jr., M. , Lee, T.W. , Qasim, M.A.
Primary Citation of Related Structures: 2GKV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Streptogrisin B | E | 185 | Meleagris Gallopavo , Streptomyces Griseus | ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY |
| Ovomucoid | A | 51 | Meleagris Gallopavo , Streptomyces Griseus | VDCSEYPKPACTLEYRPLCGSDNKTYANKCNFCNAVVESNGTLTLSHFGKC |
| Ovomucoid | B | 51 | Meleagris Gallopavo , Streptomyces Griseus | VDCSEYPKPACTLEYRPLCGSDNKTYANKCNFCNAVVESNGTLTLSHFGKC |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-04-03 Deposition Author(s): James, M.N.G. , Laskowski Jr., M. , Lee, T.W. , Qasim, M.A.