Crystal structure of homoserine o-succinyltransferase (np_981826.1) from bacillus cereus atcc 10987 at 2.40 a resolution
PDB DOI: 10.2210/pdb2ghr/pdb
Classification: TRANSFERASE Organism(s): Bacillus Cereus
Deposited: 2006-03-27 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Crystal structure of homoserine o-succinyltransferase (np_981826.1) from bacillus cereus atcc 10987 at 2.40 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 2GHR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Homoserine O-succinyltransferase | A | 302 | Bacillus Cereus | GMPIIIDKDLPARKVLQEENIFVMTKERAETQDIRALKIAILNLMPTKQETEAQLLRLIGNTPLQLDVHLLHMESHLSRNVAQEHLTSFYKTFRDIENEKFDGLIITGAPVETLSFEEVDYWEELKRIMEYSKTNVTSTLHICWGAQAGLYHHYGVQKYPLKEKMFGVFEHEVREQHVKLLQGFDELFFAPHSRHTEVRESDIREVKELTLLANSEEAGVHLVIGQEGRQVFALGHSEYSCDTLKQEYERDRDKGLNIDVPKNYFKHDNPNEKPLVRWRSHGNLLFSNWLNYYVYQETPYVL |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-03-27 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)