Fowlicidin-2: nmr structure of antimicrobial peptide
PDB DOI: 10.2210/pdb2gdl/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): N.A.
Deposited: 2006-03-16 Deposition Author(s): Herrera, A.I. , Prakash, O. , Zhang, G.
Method: SOLUTION NMR Resolution: N.A.
Fowlicidin-2: nmr structure of antimicrobial peptide
Herrera, A.I. , Prakash, O. , Zhang, G.
Primary Citation of Related Structures: 2GDL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| myeloid antimicrobial peptide 27 | A | 31 | N.A. | LVQRGRFGRFLRKIRRFRPKVTITIQGSARF |
Method: SOLUTION NMR
Deposited Date: 2006-03-16 Deposition Author(s): Herrera, A.I. , Prakash, O. , Zhang, G.