Crystal structure of the sh3 domain of betapix in complex with a high affinity peptide from pak2
PDB DOI: 10.2210/pdb2g6f/pdb
Classification: SIGNALING PROTEIN Organism(s): Pandinus Imperator
Deposited: 2006-02-24 Deposition Author(s): Hoelz, A.
Method: X-RAY DIFFRACTION Resolution: 0.92 Å
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Rho guanine nucleotide exchange factor 7 | X | 59 | Pandinus Imperator | GPLGSVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREI |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-02-24 Deposition Author(s): Hoelz, A.