PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

2G46

Structure of vset in complex with mek27 h3 pept. and cofactor product sah

PDB DOI: 10.2210/pdb2g46/pdb

Classification: TRANSFERASE
Organism(s): Listeria Monocytogenes Str. 4B H7858 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2006-02-21
Deposition Author(s): Qian, C.M. , Zheng, L. , Zhou, M.M.

Experimental Data Snapshot

Method: SOLUTION NMR
Resolution: N.A.

Literature

Structure of vset in complex with mek27 h3 pept. and cofactor product sah

Qian, C.M. , Zheng, L. , Zhou, M.M.

Primary Citation of Related Structures: 2G46


Proteins
Molecule Chains Sequence Length Organism Sequence
PBCV-1 histone H3-Lys 27 methyltransferase A 119 Listeria Monocytogenes Str. 4B H7858 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
PBCV-1 histone H3-Lys 27 methyltransferase B 119 Listeria Monocytogenes Str. 4B H7858 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) MFNDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALEDYLFSRKNMSAMALGFGAIFNHSKDPNARHELTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLTQN
meK27 H3 Peptide C 21 Listeria Monocytogenes Str. 4B H7858 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GKAPRKQLATKAARKSAPATG
meK27 H3 Peptide D 21 Listeria Monocytogenes Str. 4B H7858 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GKAPRKQLATKAARKSAPATG
Experimental Data

Method: SOLUTION NMR

Deposited Date: 2006-02-21
Deposition Author(s): Qian, C.M. , Zheng, L. , Zhou, M.M.