Photolyzed co l29f myoglobin: 31.6ns
PDB DOI: 10.2210/pdb2g11/pdb
Classification: TRANSPORT PROTEIN Organism(s): Physeter Catodon
Deposited: 2006-02-13 Deposition Author(s): Anfinrud, P.A. , Aranda, R. , Levin, E.J. , Phillips Jr., G.N. , Schotte, F.
Photolyzed co l29f myoglobin: 31.6ns
Anfinrud, P.A. , Aranda, R. , Levin, E.J. , Phillips Jr., G.N. , Schotte, F.
Primary Citation of Related Structures: 2G11
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myoglobin | A | 154 | Physeter Catodon | MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-02-13 Deposition Author(s): Anfinrud, P.A. , Aranda, R. , Levin, E.J. , Phillips Jr., G.N. , Schotte, F.