Solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abh
PDB DOI: 10.2210/pdb2fy9/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Subtilis
Deposited: 2006-02-07 Deposition Author(s): Bobay, B.G. , Cavanagh, J.
Solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abh
Primary Citation of Related Structures: 2FY9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Putative transition state regulator abh | A | 54 | Bacillus Subtilis | MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVC |
Putative transition state regulator abh | B | 54 | Bacillus Subtilis | MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVC |
Method: SOLUTION NMR
Deposited Date: 2006-02-07 Deposition Author(s): Bobay, B.G. , Cavanagh, J.