2FUI
Nmr solution structure of phd finger fragment of human bptf in free state
PDB DOI: 10.2210/pdb2fui/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica
Deposited: 2006-01-26 Deposition Author(s): Ilin, S. , Patel, D.J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of phd finger fragment of human bptf in free state
Primary Citation of Related Structures: 2FUI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| bromodomain PHD finger transcription factor | A | 62 | Salmonella Enterica | GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2006-01-26 Deposition Author(s): Ilin, S. , Patel, D.J.