Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution
PDB DOI: 10.2210/pdb2ftr/pdb
Classification: UNKNOWN FUNCTION Organism(s): Bacillus Halodurans
Deposited: 2006-01-24 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 2FTR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BH0200 | A | 108 | Bacillus Halodurans | GMKGENMMVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDMKVTRIVGSPMGESKFYLMCEMYYDDHESLQQAMRTDEGKASGKDAMKFAGKLLTLMIGEEMDE |
| BH0200 | B | 108 | Bacillus Halodurans | GMKGENMMVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDMKVTRIVGSPMGESKFYLMCEMYYDDHESLQQAMRTDEGKASGKDAMKFAGKLLTLMIGEEMDE |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-01-24 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)