The crystal structure of the n-terminal domain of hausp/usp7 complexed with p53 peptide 364-367
PDB DOI: 10.2210/pdb2foj/pdb
Classification: HYDROLASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-01-13 Deposition Author(s): Arrowsmith, C.H. , Duan, S. , Frappier, L. , Saridakis, V. , Sarkari, F. , Sheng, Y. , Wu, T.
The crystal structure of the n-terminal domain of hausp/usp7 complexed with p53 peptide 364-367
Arrowsmith, C.H. , Duan, S. , Frappier, L. , Saridakis, V. , Sarkari, F. , Sheng, Y. , Wu, T.
Primary Citation of Related Structures: 2FOJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ubiquitin carboxyl-terminal hydrolase 7 | A | 155 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAW |
p53 peptide | B | 7 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GARAHSS |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-01-13 Deposition Author(s): Arrowsmith, C.H. , Duan, S. , Frappier, L. , Saridakis, V. , Sarkari, F. , Sheng, Y. , Wu, T.