2FNX
Design of specific peptide inhibitors of phospholipase a2 (pla2): crystal structure of the complex of pla2 with a highly potent peptide val-ile-ala-lys at 2.7a resolution
PDB DOI: 10.2210/pdb2fnx/pdb
Classification: HYDROLASE Organism(s): Tick-Borne Encephalitis Virus (Strain Sofjin) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-01-11 Deposition Author(s): Dey, S. , Sharma, S. , Singh, N. , Singh, T.P. , Srivastava, P.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.7 Å
Design of specific peptide inhibitors of phospholipase a2 (pla2): crystal structure of the complex of pla2 with a highly potent peptide val-ile-ala-lys at 2.7a resolution
Dey, S. , Sharma, S. , Singh, N. , Singh, T.P. , Srivastava, P.
Primary Citation of Related Structures: 2FNX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phospholipase A2 VRV-PL-VIIIa | A | 121 | Tick-Borne Encephalitis Virus (Strain Sofjin) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC |
| Inhibitor peptide | P | 4 | Tick-Borne Encephalitis Virus (Strain Sofjin) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | VIAK |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-01-11 Deposition Author(s): Dey, S. , Sharma, S. , Singh, N. , Singh, T.P. , Srivastava, P.