Nmr structure of the fibronectin ed-b domain, nmr, 20 structures
PDB DOI: 10.2210/pdb2fnb/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 1998-12-16 Deposition Author(s): Fattorusso, R. , Neri, D. , Neri, P. , Pellecchia, M. , Viti, F. , Wuthrich, K.
Nmr structure of the fibronectin ed-b domain, nmr, 20 structures
Fattorusso, R. , Neri, D. , Neri, P. , Pellecchia, M. , Viti, F. , Wuthrich, K.
Primary Citation of Related Structures: 2FNB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN (FIBRONECTIN) | A | 95 | Homo Sapiens | MRGSEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT |
Method: SOLUTION NMR
Deposited Date: 1998-12-16 Deposition Author(s): Fattorusso, R. , Neri, D. , Neri, P. , Pellecchia, M. , Viti, F. , Wuthrich, K.