Nmr structure of the neurabin pdz domain (502-594)
PDB DOI: 10.2210/pdb2fn5/pdb
Classification: SIGNALING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2006-01-10 Deposition Author(s): Dancheck, B. , Peti, W.
Nmr structure of the neurabin pdz domain (502-594)
Primary Citation of Related Structures: 2FN5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Neurabin-1 | A | 94 | Rattus Norvegicus | GHMELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGRE |
Method: SOLUTION NMR
Deposited Date: 2006-01-10 Deposition Author(s): Dancheck, B. , Peti, W.