Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, atomic resolution
PDB DOI: 10.2210/pdb2fma/pdb
Classification: METAL BINDING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2006-01-08 Deposition Author(s): Kong, G.K.-W.
Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, atomic resolution
Primary Citation of Related Structures: 2FMA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Amyloid beta A4 protein precursor | A | 59 | Salmonella Enterica | EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-01-08 Deposition Author(s): Kong, G.K.-W.