Structure of the 2[4fe-4s] ferredoxin from pseudomonas aeruginosa
PDB DOI: 10.2210/pdb2fgo/pdb
Classification: ELECTRON TRANSPORT Organism(s): Pseudomonas Aeruginosa
Deposited: 2005-12-22 Deposition Author(s): Giastas, P. , Mavridis, I.M. , Pinotsis, N.
Structure of the 2[4fe-4s] ferredoxin from pseudomonas aeruginosa
Giastas, P. , Mavridis, I.M. , Pinotsis, N.
Primary Citation of Related Structures: 2FGO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ferredoxin | A | 82 | Pseudomonas Aeruginosa | SLKITDDCINCDVCEPECPNGAISQGEEIYVIDPNLCTECVGHYDEPQCQQVCPVDCIPLDDANVESKDQLMEKYRKITGKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-12-22 Deposition Author(s): Giastas, P. , Mavridis, I.M. , Pinotsis, N.