Solution structure of steroidogenic factor 1 dna binding domain bound to its target sequence in the inhibin alpha-subunit promoter
PDB DOI: 10.2210/pdb2ff0/pdb
Classification: Hormone/Growth factor/DNA Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2005-12-17 Deposition Author(s): Little, T.H. , Matulis, C.K. , Mayo, K.E. , Radhakrishnan, I. , Ramachandran, A. , Weck, J. , Zhang, Y. , Zhang, Z.
Solution structure of steroidogenic factor 1 dna binding domain bound to its target sequence in the inhibin alpha-subunit promoter
Little, T.H. , Matulis, C.K. , Mayo, K.E. , Radhakrishnan, I. , Ramachandran, A. , Weck, J. , Zhang, Y. , Zhang, Z.
Primary Citation of Related Structures: 2FF0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Steroidogenic factor 1 | A | 102 | Mus Musculus , Synthetic Construct | DELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKA |
Method: SOLUTION NMR
Deposited Date: 2005-12-17 Deposition Author(s): Little, T.H. , Matulis, C.K. , Mayo, K.E. , Radhakrishnan, I. , Ramachandran, A. , Weck, J. , Zhang, Y. , Zhang, Z.