2FCI
Structural basis for the requirement of two phosphotyrosines in signaling mediated by syk tyrosine kinase
PDB DOI: 10.2210/pdb2fci/pdb
Classification: HYDROLASE Organism(s): Parengyodontium Album , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-12-12 Deposition Author(s): Geahlen, R.L. , Groesch, T.D. , Mattila, S. , Post, C.B. , Zhou, F.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structural basis for the requirement of two phosphotyrosines in signaling mediated by syk tyrosine kinase
Geahlen, R.L. , Groesch, T.D. , Mattila, S. , Post, C.B. , Zhou, F.
Primary Citation of Related Structures: 2FCI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Doubly phosphorylated peptide derived from Syk kinase comprising residues 338-350 | B | 14 | Parengyodontium Album , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XDTEVYESPYADPE |
| C-termainl SH2 domain from phospholipase C-gamma-1 comprising residues 663-759 | A | 105 | Parengyodontium Album , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSPGIHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEENSS |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-12-12 Deposition Author(s): Geahlen, R.L. , Groesch, T.D. , Mattila, S. , Post, C.B. , Zhou, F.