Structure of cdtb, the biologically active subunit of cytolethal distending toxin
PDB DOI: 10.2210/pdb2f1n/pdb
Classification: TOXIN Organism(s): Escherichia Coli
Deposited: 2005-11-14 Deposition Author(s): Dreyfus, L.A. , Hontz, J.S. , Yoder, M.D.
Structure of cdtb, the biologically active subunit of cytolethal distending toxin
Dreyfus, L.A. , Hontz, J.S. , Yoder, M.D.
Primary Citation of Related Structures: 2F1N
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytolethal distending toxin subunit B | A | 262 | Escherichia Coli | MAHHHHHHVGTDLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGRVIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-11-14 Deposition Author(s): Dreyfus, L.A. , Hontz, J.S. , Yoder, M.D.