Solution structure of the docking and dimerization domain of the type i alpha regulatory subunit of protein kinase a (rialpha d/d)
PDB DOI: 10.2210/pdb2ezw/pdb
Classification: TRANSFERASE Organism(s): Bos Taurus
Deposited: 2005-11-10 Deposition Author(s): Banky, P.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase type I-alpha regulatory subunit | A | 50 | Bos Taurus | SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK |
| cAMP-dependent protein kinase type I-alpha regulatory subunit | B | 50 | Bos Taurus | SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEAK |
Method: SOLUTION NMR
Deposited Date: 2005-11-10 Deposition Author(s): Banky, P.