Solution structure of the dnedd4 ww3* domain- comm lpsy peptide complex
PDB DOI: 10.2210/pdb2ez5/pdb
Classification: SIGNALLING PROTEIN,LIGASE Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2005-11-10 Deposition Author(s): Bruce, M.C. , Forman-Kay, J.D. , Kanelis, V. , Rotin, D. , Skrynnikov, N.R.
Solution structure of the dnedd4 ww3* domain- comm lpsy peptide complex
Bruce, M.C. , Forman-Kay, J.D. , Kanelis, V. , Rotin, D. , Skrynnikov, N.R.
Primary Citation of Related Structures: 2EZ5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4 | W | 46 | Drosophila Melanogaster , Synthetic Construct | GPLGSGEEEPLPPRWSMQVAPNGRTFFIDHASRRTTWIDPRNGRAS |
| Commissureless LPSY Peptide | P | 11 | Drosophila Melanogaster , Synthetic Construct | TGLPSYDEALH |
Method: SOLUTION NMR
Deposited Date: 2005-11-10 Deposition Author(s): Bruce, M.C. , Forman-Kay, J.D. , Kanelis, V. , Rotin, D. , Skrynnikov, N.R.