Structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form i
PDB DOI: 10.2210/pdb2evb/pdb
Classification: LIPID BINDING PROTEIN,TRANSFERASE Organism(s): Pyrococcus Horikoshii
Deposited: 2005-10-31 Deposition Author(s): Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form i
Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Primary Citation of Related Structures: 2EVB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| methylmalonyl-CoA decarboxylase gamma chain | A | 74 | Pyrococcus Horikoshii | MVVSENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG | 
Method: X-RAY DIFFRACTION
Deposited Date: 2005-10-31 Deposition Author(s): Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)