2EU0
The nmr ensemble structure of the itk sh2 domain bound to a phosphopeptide
PDB DOI: 10.2210/pdb2eu0/pdb
Classification: TRANSFERASE Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-10-27 Deposition Author(s): Andreotti, A.H. , Fulton, D.B. , Pletneva, E.V. , Sundd, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
The nmr ensemble structure of the itk sh2 domain bound to a phosphopeptide
Andreotti, A.H. , Fulton, D.B. , Pletneva, E.V. , Sundd, M.
Primary Citation of Related Structures: 2EU0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase ITK/TSK | A | 109 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCG |
| Lymphocyte cytosolic protein 2 phosphopeptide fragment | B | 8 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XADYEPPX |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-10-27 Deposition Author(s): Andreotti, A.H. , Fulton, D.B. , Pletneva, E.V. , Sundd, M.