2ESY
Structure and influence on stability and activity of the n-terminal propetide part of lung surfactant protein c
PDB DOI: 10.2210/pdb2esy/pdb
Classification: LIPID BINDING PROTEIN Organism(s): N.A.
Deposited: 2005-10-27 Deposition Author(s): Almlen, A. , Curstedt, T. , Johansson, J. , Jornvall, H. , Li, J. , Liepinsh, E. , Thyberg, J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure and influence on stability and activity of the n-terminal propetide part of lung surfactant protein c
Almlen, A. , Curstedt, T. , Johansson, J. , Jornvall, H. , Li, J. , Liepinsh, E. , Thyberg, J.
Primary Citation of Related Structures: 2ESY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| lung surfactant protein C | A | 32 | N.A. | SPPDYSAAPRGRFGIPFFPVHLKRLLILLLLX |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-10-27 Deposition Author(s): Almlen, A. , Curstedt, T. , Johansson, J. , Jornvall, H. , Li, J. , Liepinsh, E. , Thyberg, J.