2ERR
Nmr structure of the rna binding domain of human fox-1 in complex with ugcaugu
PDB DOI: 10.2210/pdb2err/pdb
Classification: RNA BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-10-25 Deposition Author(s): Allain, F.H. , Auweter, S.D.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the rna binding domain of human fox-1 in complex with ugcaugu
Primary Citation of Related Structures: 2ERR
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| UGCAUGU | b | 7 | NA | UGCAUGU |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ataxin-2-binding protein 1 | A | 109 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGSSHHHHHHSSGLVPRGSHMNTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVM |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-10-25 Deposition Author(s): Allain, F.H. , Auweter, S.D.