Crystal structure of a leu3 dna-binding domain complexed with a 15mer dna duplex
PDB DOI: 10.2210/pdb2ere/pdb
Classification: TRANSCRIPTION ACTIVATOR/DNA Organism(s): Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-10-24 Deposition Author(s): Fitzgerald, M.X. , Marmorstein, R.
Crystal structure of a leu3 dna-binding domain complexed with a 15mer dna duplex
Fitzgerald, M.X. , Marmorstein, R.
Primary Citation of Related Structures: 2ERE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Regulatory protein LEU3 | A | 72 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KRKFACVECRQQKSKCDAHERAPEPCTKCAKKNVPCILKRDFRRTYKRARNEAIEKRFKELTRTLTNLTSDE |
Regulatory protein LEU3 | B | 72 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KRKFACVECRQQKSKCDAHERAPEPCTKCAKKNVPCILKRDFRRTYKRARNEAIEKRFKELTRTLTNLTSDE |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-10-24 Deposition Author(s): Fitzgerald, M.X. , Marmorstein, R.