Solution structure of the tudor domain of metal-response element-binding transcription factor 2
PDB DOI: 10.2210/pdb2eqj/pdb
Classification: TRANSCRIPTION Organism(s): Mus Musculus
Deposited: 2007-03-30 Deposition Author(s): Dang, W. , Isono, K. , Kigawa, T. , Koseki, H. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tarada, T. , Watanabe, S. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the tudor domain of metal-response element-binding transcription factor 2
Dang, W. , Isono, K. , Kigawa, T. , Koseki, H. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tarada, T. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2EQJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Metal-response element-binding transcription factor 2 | A | 66 | Mus Musculus | GSSGSSGKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGAT |
Method: SOLUTION NMR
Deposited Date: 2007-03-30 Deposition Author(s): Dang, W. , Isono, K. , Kigawa, T. , Koseki, H. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tarada, T. , Watanabe, S. , Yokoyama, S.