Solution structure of the 7th a20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3
PDB DOI: 10.2210/pdb2eqf/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2007-03-30 Deposition Author(s): Hayahsi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the 7th a20-type zinc finger domain from human tumor necrosis factor, alpha-induced protein3
Hayahsi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Primary Citation of Related Structures: 2EQF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tumor necrosis factor, alpha-induced protein 3 | A | 46 | Homo Sapiens | GSSGSSGPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYGSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-03-30 Deposition Author(s): Hayahsi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.