Solution structure of the third c2h2 type zinc finger domain of zinc finger protein 28 homolog
PDB DOI: 10.2210/pdb2epx/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Tanabe, W. , Terada, T. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the third c2h2 type zinc finger domain of zinc finger protein 28 homolog
Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Tanabe, W. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2EPX
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger protein 28 homolog | A | 47 | Homo Sapiens | GSSGSSGTGKKPYECIECGKAFIQNTSLIRHWRYYHTGEKPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-03-30 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Tanabe, W. , Terada, T. , Yokoyama, S.