Solution structure of the c2h2 type zinc finger (region 581-609) of human zinc finger protein 268
PDB DOI: 10.2210/pdb2eol/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-03-29 Deposition Author(s): Abe, H. , Kigawa, T. , Kobayashi, N. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Sato, M. , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Solution structure of the c2h2 type zinc finger (region 581-609) of human zinc finger protein 268
Abe, H. , Kigawa, T. , Kobayashi, N. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Sato, M. , Tochio, N. , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 2EOL
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger protein 268 | A | 42 | Homo Sapiens | GSSGSSGEKPYECTDCGKAFGLKSQLIIHQRTHTGESGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-03-29 Deposition Author(s): Abe, H. , Kigawa, T. , Kobayashi, N. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Sato, M. , Tochio, N. , Tomizawa, T. , Yokoyama, S.