Solution structure of the second c2h2-type zinc finger domain from human krueppel-like factor 15
PDB DOI: 10.2210/pdb2ent/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica
Deposited: 2007-03-28 Deposition Author(s): Hayashi, F. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Solution structure of the second c2h2-type zinc finger domain from human krueppel-like factor 15
Hayashi, F. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 2ENT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Krueppel-like factor 15 | A | 48 | Salmonella Enterica | GSSGSSGTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-03-28 Deposition Author(s): Hayashi, F. , Nagashima, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.