2ELZ
Solution structure of the 17th zf-c2h2 domain from human zinc finger protein 224
PDB DOI: 10.2210/pdb2elz/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-03-28 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the 17th zf-c2h2 domain from human zinc finger protein 224
Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 2ELZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger protein 224 | A | 46 | Homo Sapiens | GSSGSSGSVEKPYKCEDCGKGYNRRLNLDMHQRVHMGEKTSGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-03-28 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.