Solution structure of the 2nd c2h2 zinc finger of human zinc finger protein 406
PDB DOI: 10.2210/pdb2els/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-03-27 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tanaka, A. , Tochio, N. , Umehara, T. , Watanabe, S. , Yokoyama, S. , Yoneyama, M.
Solution structure of the 2nd c2h2 zinc finger of human zinc finger protein 406
Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tanaka, A. , Tochio, N. , Umehara, T. , Watanabe, S. , Yokoyama, S. , Yoneyama, M.
Primary Citation of Related Structures: 2ELS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger protein 406 | A | 36 | Homo Sapiens | GSSGSSGKIFTCEYCNKVFKFKHSLQAHLRIHTNEK |
Method: SOLUTION NMR
Deposited Date: 2007-03-27 Deposition Author(s): Harada, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tanaka, A. , Tochio, N. , Umehara, T. , Watanabe, S. , Yokoyama, S. , Yoneyama, M.