Solution structure of the 18th zf-c2h2 domain from human zinc finger protein 268
PDB DOI: 10.2210/pdb2el5/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2007-03-26 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Solution structure of the 18th zf-c2h2 domain from human zinc finger protein 268
Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 2EL5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger protein 268 | A | 42 | Homo Sapiens | GSSGSSGENPYECSECGKAFNRKDQLISHQRTHAGESGPSSG |
Method: SOLUTION NMR
Deposited Date: 2007-03-26 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.