2EKK
Solution structure of ruh-074, a human uba domain
PDB DOI: 10.2210/pdb2ekk/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2007-03-23 Deposition Author(s): Hirota, H. , Kitasaka, S. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Ruhul Momen, A.Z.M. , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of ruh-074, a human uba domain
Hirota, H. , Kitasaka, S. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Ruhul Momen, A.Z.M. , Yokoyama, S.
Primary Citation of Related Structures: 2EKK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| UBA domain from E3 ubiquitin-protein ligase HUWE1 | A | 47 | Homo Sapiens | GSSGSSGVNQQQLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHP |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-03-23 Deposition Author(s): Hirota, H. , Kitasaka, S. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Ruhul Momen, A.Z.M. , Yokoyama, S.